SARP Antibody

Images

 
Western Blot: SARP Antibody [NBP1-70700] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SARP Antibody Summary

Immunogen
Synthetic peptides corresponding to ANKRD42 (ankyrin repeat domain 42) The peptide sequence was selected from the N terminal of ANKRD42. Peptide sequence PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD42
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ANKRD42 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SARP Antibody

  • ankyrin repeat domain 42

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1384
Species: Hu
Applications: WB, IHC, ICC
1169-FR/CF
Species: Mu
NB110-38889
Species: Hu
Applications: WB, IP
NBP2-20331
Species: Hu
Applications: WB, IHC, IHC-P
MAB3000
Species: Hu, Mu, Rt
Applications: WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55967
Species: Hu
Applications: ICC/IF
H00026051-D01P
Species: Hu
Applications: WB, ELISA
NLS1071
Species: Hu
Applications: IHC-P
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2859
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-46781
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
MAB6967
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
AF4004
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-82600
Species: Hu
Applications: IHC, IHC-P
NBP1-70700
Species: Hu
Applications: WB

Publications for SARP Antibody (NBP1-70700) (0)

There are no publications for SARP Antibody (NBP1-70700).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARP Antibody (NBP1-70700) (0)

There are no reviews for SARP Antibody (NBP1-70700). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SARP Antibody (NBP1-70700) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SARP Products

Bioinformatics Tool for SARP Antibody (NBP1-70700)

Discover related pathways, diseases and genes to SARP Antibody (NBP1-70700). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SARP

There are no specific blogs for SARP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD42