SAMSN1 Recombinant Protein Antigen

Images

 
There are currently no images for SAMSN1 Protein (NBP1-82599PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SAMSN1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SAMSN1.

Source: E. coli

Amino Acid Sequence: TEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SAMSN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82599.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SAMSN1 Recombinant Protein Antigen

  • HACS1gene with homology to KIAA0790 protein10NASH1
  • Hematopoietic adaptor containing SH3 and SAM domains 1
  • SAM and SH3 domain containing 1
  • SAM and SH3 domain containing 2
  • SAM domain, SH3 domain and nuclear localisation signals, 1
  • SAM domain, SH3 domain and nuclear localization signals 1
  • SAM domain, SH3 domain and nuclear localization signals protein 1
  • SAM domain-containing protein SAMSN-1
  • SH3D6B
  • SH3-SAM adaptor protein

Background

SAMSN1 is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains. It also contains several predicted consensus nuclear localization signals and a tyrosine kinase phosphorylation motif. Northern blot analysis has revealed expression of a 2.2kb SAMSN1 transcript in human immune tissues and hematopoietic cell types including normal bone marrow, acute myeloid leukemia, and multiple myeloma; low-level expression was seen in other tissues such as heart, brain, placenta, and lung. SAMSN1 has been shown to be up-regulated by B cell activation signals and is a participant in B cell activation and differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP1-92364
Species: Hu
Applications: IHC,  IHC-P
NBP2-02031
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
H00008819-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15971
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF3206
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
H00001859-M01
Species: Hu, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB123
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
DCDL40
Species: Hu
Applications: ELISA
NBP1-82599PEP
Species: Hu
Applications: AC

Publications for SAMSN1 Protein (NBP1-82599PEP) (0)

There are no publications for SAMSN1 Protein (NBP1-82599PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMSN1 Protein (NBP1-82599PEP) (0)

There are no reviews for SAMSN1 Protein (NBP1-82599PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SAMSN1 Protein (NBP1-82599PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAMSN1 Products

Research Areas for SAMSN1 Protein (NBP1-82599PEP)

Find related products by research area.

Blogs on SAMSN1

There are no specific blogs for SAMSN1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SAMSN1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SAMSN1