SAMD3 Antibody

Western Blot: SAMD3 Antibody [NBP1-88732] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunohistochemistry-Paraffin: SAMD3 Antibody [NBP1-88732] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Discontinued

SAMD3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WKRALKDRFKYVRRPIEDDEQVIRNKCKFGHRRGQTRKSLADIRFDEIKLVQIKEEAVCFDSELDEHIKWFQQEYVKTEKDWR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SAMD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SAMD3 Antibody

• bA73O6.2
• FLJ34032
• FLJ34563
• MGC35163
• SAM domain-containing protein 3
• sterile alpha motif domain containing 3
• sterile alpha motif domain-containing protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SAMD3 Antibody (NBP1-88732)(1)

Publication using NBP1-88732

• Fang M, Liu K, Li X et al. AntagomiR-29b inhibits vascular and valvular calcification and improves heart function in rats J. Cell. Mol. Med. 2020-08-26 [PMID: 32845082] (WB, Rat)

Bioinformatics

• Gene Symbol: SAMD3