Recombinant Human Salivary Amylase Alpha Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Salivary Amylase Alpha Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 172-245 of Human Salivary Amylase Alpha

Source: Wheat Germ

Amino Acid Sequence: VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
AMY1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
33.88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Salivary Amylase Alpha Protein

  • 1,4-alpha-D-glucan glucanohydrolase 1
  • alpha-amylase 1
  • AMY1
  • AMY1B
  • AMY1C
  • amylase, alpha 1A (salivary)
  • amylase, alpha 1A; salivary
  • amylase, salivary, alpha-1A
  • EC 3.2.1.1
  • glycogenase
  • Salivary alpha-amylase
  • salivary amylase alpha 1A

Background

AMY1A - amylase, alpha 1A; salivary

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45492
Species: Hu
Applications: WB, IHC
AF4317
Species: Hu
Applications: WB
AF4636
Species: Mu
Applications: WB
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00026292-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
7570-GH
Species: Hu
NBP1-47615
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
H00000276-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01) (0)

There are no publications for Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01) (0)

There are no reviews for Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Salivary Amylase Alpha Products

Bioinformatics Tool for Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01)

Discover related pathways, diseases and genes to Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01)

Discover more about diseases related to Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01).
 

Pathways for Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01)

View related products by pathway.

PTMs for Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01)

Learn more about PTMs related to Salivary Amylase Alpha Partial Recombinant Protein (H00000276-Q01).

Blogs on Salivary Amylase Alpha

There are no specific blogs for Salivary Amylase Alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Salivary Amylase Alpha Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AMY1A