RXFP4/GPCR142/GPR100 Antibody - BSA Free

Western Blot: RXFP4/GPCR142/GPR100 Antibody [NBP2-86788] - WB Suggested Anti-RXFP4 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RXFP4/GPCR142/GPR100 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of RXFP4/GPCR142/GPR100. Peptide sequence: RDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RXFP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RXFP4/GPCR142/GPR100 Antibody - BSA Free

• G protein-coupled receptor 100
• GPCR142
• GPR100
• Relaxin-3 receptor-2
• RLN3R2
• RXFP4 relaxin/insulin-like family peptide receptor 4
• RXFP4
• RXFPR4
• SALPR

Background

GPR100 is a Bradykinin receptor. This gene is highly homologous to SALPR. Liu et al. 2003 called the gene GPCR142, although it is not the same gene as the putative orphan receptor GPR142. GPR100 has been shown to express widely in the human body. ESTs have been isolated from bone marrow, brain, and prostate cancer libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RXFP4