RUVBL2 Antibody

Western Blot: RUVBL2 Antibody [H00010856-B01P] - Analysis of RUVBL2 expression in human pancreas.

Immunocytochemistry/Immunofluorescence: RUVBL2 Antibody [H00010856-B01P] - Analysis of purified antibody to RUVBL2 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: RUVBL2 Antibody [H00010856-B01P] - Analysis of RUVBL2 expression in HeLa.

Western Blot: RUVBL2 Antibody [H00010856-B01P] - Analysis of RUVBL2 expression in transfected 293T cell line by RUVBL2 polyclonal antibody. Lane 1: RUVBL2 transfected lysate(50.93 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

RUVBL2 Antibody Summary

• Immunogen: RUVBL2 (NP_006657.1, 1 a.a. - 463 a.a.) full-length human protein. MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
• Specificity: RUVBL2 - RuvB-like 2 (E. coli),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RUVBL2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RUVBL2 Antibody

• 48 kDa TATA box-binding protein-interacting protein
• 51 kDa erythrocyte cytosolic protein
• EC 3.6.1
• EC 3.6.4.12,48 kDa TBP-interacting protein
• ECP51TIP49B
• erythrocyte cytosolic protein, 51-KD
• INO80 complex subunit J
• INO80JTAP54-beta
• Repressing pontin 52
• Reptin 52
• REPTIN
• Reptin52
• RuvB (E coli homolog)-like 2
• RuvB-like 2 (E. coli)
• ruvB-like 2
• RVB2
• TBP-interacting protein, 48-KD
• TIH2
• TIP48ECP-51
• TIP49b
• TIP60-associated protein 54-beta

Background

This gene encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RUVBL2 Antibody (H00010856-B01P)(1)

Publication using H00010856-B01P

• Maslon MM, Hrstka R, Vojtesek B, Hupp TR. A divergent substrate-binding loop within the pro-oncogenic protein anterior gradient-2 forms a docking site for Reptin. J Mol Biol 404(3):418-38. 2010-12-03 [PMID: 20888340]

Bioinformatics

• Gene Symbol: RUVBL2
• Entrez:
  • 10856(Human)
• Uniprot:
  • NP_006657.1(Human)