RUNDC3B Antibody


Immunohistochemistry-Paraffin: RUNDC3B Antibody [NBP2-31661] - Staining of human small intestine shows strong cytoplasmic positivity in endocrine cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

RUNDC3B Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTLNVMSEGKEDTPS
Specificity of human RUNDC3B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RUNDC3B Protein (NBP2-31661PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RUNDC3B Antibody

  • Rap2 binding protein 9
  • Rap2-binding protein 9
  • Rap2-interacting protein 9
  • RPIB9FLJ30671
  • RPIP-9
  • RPIP9MGC26655
  • RUN domain containing 3B
  • RUN domain-containing protein 3B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu

Publications for RUNDC3B Antibody (NBP2-31661) (0)

There are no publications for RUNDC3B Antibody (NBP2-31661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNDC3B Antibody (NBP2-31661) (0)

There are no reviews for RUNDC3B Antibody (NBP2-31661). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RUNDC3B Antibody (NBP2-31661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RUNDC3B Products

Bioinformatics Tool for RUNDC3B Antibody (NBP2-31661)

Discover related pathways, diseases and genes to RUNDC3B Antibody (NBP2-31661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNDC3B Antibody (NBP2-31661)

Discover more about diseases related to RUNDC3B Antibody (NBP2-31661).

Blogs on RUNDC3B

There are no specific blogs for RUNDC3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RUNDC3B Antibody and receive a gift card or discount.


Gene Symbol RUNDC3B