RUNDC3B Antibody

Images

 
Immunohistochemistry-Paraffin: RUNDC3B Antibody [NBP2-31654] - Staining of human fallopian tube shows strong positivity in cilia of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RUNDC3B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPPFLMDENSWFNKCKRVKQKYQLTLEQKGYLEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUNDC3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RUNDC3B Protein (NBP2-31654PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RUNDC3B Antibody

  • Rap2 binding protein 9
  • Rap2-binding protein 9
  • Rap2-interacting protein 9
  • RPIB9FLJ30671
  • RPIP-9
  • RPIP9MGC26655
  • RUN domain containing 3B
  • RUN domain-containing protein 3B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46466
Species: Hu
Applications: IHC
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24574
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
NBP1-80855
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00026025-R01
Species: Hu
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6379
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF877
Species: Hu
Applications: WB, IHC, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80271
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1394
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-59448
Species: Hu
Applications: WB

Publications for RUNDC3B Antibody (NBP2-31654) (0)

There are no publications for RUNDC3B Antibody (NBP2-31654).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNDC3B Antibody (NBP2-31654) (0)

There are no reviews for RUNDC3B Antibody (NBP2-31654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RUNDC3B Antibody (NBP2-31654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RUNDC3B Products

Bioinformatics Tool for RUNDC3B Antibody (NBP2-31654)

Discover related pathways, diseases and genes to RUNDC3B Antibody (NBP2-31654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNDC3B Antibody (NBP2-31654)

Discover more about diseases related to RUNDC3B Antibody (NBP2-31654).

Blogs on RUNDC3B

There are no specific blogs for RUNDC3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNDC3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNDC3B
Uniprot