RTVP-1/GLIPR1 Recombinant Protein Antigen

Images

 
There are currently no images for RTVP-1/GLIPR1 Protein (NBP1-81825PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RTVP-1/GLIPR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLIPR1.

Source: E. coli

Amino Acid Sequence: NEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLIPR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81825.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RTVP-1/GLIPR1 Recombinant Protein Antigen

  • GLI pathogenesis-related 1 (glioma)
  • GLI pathogenesis-related 1
  • GliPR 1
  • GliPR
  • GLIPR1
  • GLIPRglioma pathogenesis-related protein 1
  • Protein RTVP-1
  • related to testis-specific, vespid, and pathogenesis proteins 1
  • RTVP1
  • RTVP-1
  • RTVP1CRISP7
  • testes-specific vespid and pathogenesis protein 1

Background

The protein encoded by the GLIPR1 gene works as a proapoptic initiator in prostate and bladder cells. Not all variants of the GLIPR1 gene have been documented even though multiple isoforms have been described (isoform 1: 255 AA long, 30 kDA; isoform 2: 237 AA long, nearly 30 kDA). The glioma pathogenesis-related protein 1 provided by the GLIPR1 gene is related to both the pathogenesis-related protein (PR) superfamily as well as the cysteine-rich secretory protein (CRISP) family. GLIPR1 has been research regarding its role in Wilms tumors, neuronitis, prostatitis, leukemia, glioblastoma, astrocytoma where increased expression has been linked with myelomocytic differentiation in macrophage and decreased expression (through gene methylation) has been associated to prostate cancer. The GLIPR1 gene interacts with genes CHD9, NCOA2, NCOA6, CREBBP, and CARM1 to participate in metabolism, expression of GLIPR1 and PPARA activation gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86644
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF630
Species: Hu
Applications: IHC, Neut, WB
NBP1-76985
Species: Hu, Mu, Rt
Applications: ELISA, Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
AF6386
Species: Hu
Applications: IP, WB
NBP1-89062
Species: Hu
Applications: IHC,  IHC-P, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBL1-14964
Species: Hu
Applications: WB
NBP1-86641
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-76393
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC,  IHC-P, IP, WB
H00056475-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-01650
Species: Hu, Pm, Mu
Applications: Flow, IHC,  IHC-P, WB
NBP2-81989
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-82092
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
MAB41051
Species: Hu, Mu
Applications: IHC, WB
AF1705
Species: Mu
Applications: IHC, WB

Publications for RTVP-1/GLIPR1 Protein (NBP1-81825PEP) (0)

There are no publications for RTVP-1/GLIPR1 Protein (NBP1-81825PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RTVP-1/GLIPR1 Protein (NBP1-81825PEP) (0)

There are no reviews for RTVP-1/GLIPR1 Protein (NBP1-81825PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RTVP-1/GLIPR1 Protein (NBP1-81825PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RTVP-1/GLIPR1 Products

Research Areas for RTVP-1/GLIPR1 Protein (NBP1-81825PEP)

Find related products by research area.

Blogs on RTVP-1/GLIPR1

There are no specific blogs for RTVP-1/GLIPR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RTVP-1/GLIPR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GLIPR1