RRAS Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RRAS. Source: E. coli Amino Acid Sequence: LESQRQVPRSEASAFGASHHVAYFEASAKL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
RRAS |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56964. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for RRAS Recombinant Protein Antigen
Background
R-Ras is a member of the Ras superfamily of GTPases. Ras proteins function as signaling focal points that are activated by convergent signaling pathways intiated by extracellular stimuli (reviewed in Mitin et al, 2005). Activated Ras proteins in turn regulate a diversity of downstream cytoplasmic signaling cascades. Many members of the Ras superfamily are implicated in the regulation of hematopoietic cells, with roles in growth, survival, differentiation, cytokine production, chemotaxis, vesicle-trafficking, and phagocytosis. The Ras superfamily of proteins includes over 150 small GTPases (distinguished from the large, heterotrimeric GTPases, the G-proteins). It comprises six subfamilies, the Ras, Rho, Ran, Rab, Arf, and Kir/Rem/Rad subfamilies. They exhibit considerable overall amino acid identities, especially in the regions interacting with the guanine nucleotide exchange factors that catalyze their activation. Recognizes R-Ras; human R-Ras is a 218 amino acid protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: AC
Publications for RRAS Recombinant Protein Antigen (NBP2-56964PEP) (0)
There are no publications for RRAS Recombinant Protein Antigen (NBP2-56964PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RRAS Recombinant Protein Antigen (NBP2-56964PEP) (0)
There are no reviews for RRAS Recombinant Protein Antigen (NBP2-56964PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for RRAS Recombinant Protein Antigen (NBP2-56964PEP) (0)
Additional RRAS Products
Research Areas for RRAS Recombinant Protein Antigen (NBP2-56964PEP)
Find related products by research area.
|
Blogs on RRAS