RPS6KC1 Antibody

Images

 
Western Blot: RPS6KC1 Antibody [NBP1-83141] - Analysis in control (vector only transfected HEK293T lysate) and RPS6KC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: RPS6KC1 Antibody [NBP1-83141] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: RPS6KC1 Antibody [NBP1-83141] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS6KC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VPNMVCLHKYIISEESVFLVLQHAEGGKLWSYISKFLNRSPEESFDIKEVKKPTLAKVHLQQPTSSPQDSSSFESRGSDGGSMLKALPLKSSLTPSSQDD
Specificity
Specificity of human RPS6KC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS6KC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using NBP1-83141.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPS6KC1 Antibody

  • EC 2.7.11.1
  • humS6PKh1
  • ribosomal protein S6 kinase delta-1
  • ribosomal protein S6 kinase, 52kD, polypeptide 1,52 kDa ribosomal protein S6 kinase
  • ribosomal protein S6 kinase, 52kDa, polypeptide 1
  • Ribosomal S6 kinase-like protein with two PSK domains 118 kDa protein
  • RPK118
  • S6K-delta-1
  • SPHK1-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008877-M01
Species: Hu
Applications: WB, ELISA
NBP2-67043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92389
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47203
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA, KD
NBP1-54618
Species: Hu
Applications: WB, IHC
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF4838
Species: Hu
Applications: WB, Simple Western
NBP2-80423
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52555
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB5277
Species: Hu
Applications: WB, IHC
NBP2-20237
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
6179-WN/CF
Species: Hu
NBP2-14279
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-44263
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-83141
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPS6KC1 Antibody (NBP1-83141)(1)

Reviews for RPS6KC1 Antibody (NBP1-83141) (0)

There are no reviews for RPS6KC1 Antibody (NBP1-83141). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS6KC1 Antibody (NBP1-83141) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPS6KC1 Products

Bioinformatics Tool for RPS6KC1 Antibody (NBP1-83141)

Discover related pathways, diseases and genes to RPS6KC1 Antibody (NBP1-83141). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS6KC1 Antibody (NBP1-83141)

Discover more about diseases related to RPS6KC1 Antibody (NBP1-83141).
 

Pathways for RPS6KC1 Antibody (NBP1-83141)

View related products by pathway.

PTMs for RPS6KC1 Antibody (NBP1-83141)

Learn more about PTMs related to RPS6KC1 Antibody (NBP1-83141).
 

Research Areas for RPS6KC1 Antibody (NBP1-83141)

Find related products by research area.

Blogs on RPS6KC1

There are no specific blogs for RPS6KC1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS6KC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KC1
COVID-19 update