RPS20 Antibody (9H1D4)

Immunoprecipitation: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunoprecipitation of RPS20 in 300 ug extracts from Hep G2 cells using 3 ug RPS20 Rabbit mAb . Western blot analysis was performed using RPS20 Rabbit mAb at 1:1000 dilution.

Western Blot: RPS20 Antibody (9H1D4) [NBP3-16824] - Western blot analysis of extracts of various cell lines, using RPS20 Rabbit mAb (NBP3-16824) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/Immunofluorescence: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunofluorescence analysis of C6 cells using RPS20 Rabbit mAb (NBP3-16824) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunohistochemistry analysis of RPS20 in paraffin-embedded rat brain tissue using RPS20 Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunohistochemistry analysis of RPS20 in paraffin-embedded mouse brain tissue using RPS20 Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunohistochemistry analysis of RPS20 in paraffin-embedded mouse testis tissue using RPS20 Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunohistochemistry analysis of RPS20 in paraffin-embedded human colon carcinoma tissue using RPS20 Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RPS20 Antibody (9H1D4) [NBP3-16824] - Immunohistochemistry analysis of RPS20 in paraffin-embedded rat colon tissue using RPS20 Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 9H1D4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

RPS20 Antibody (9H1D4) Summary

• Description: Novus Biologicals Rabbit RPS20 Antibody (9H1D4) (NBP3-16824) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPS20 (P60866). MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLIDLHSPSEIVKQ
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RPS20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RPS20 Antibody (9H1D4)

• 40S ribosomal protein S20
• FLJ27451
• MGC102930
• ribosomal protein S20

Background

Mammalian ribosomal proteins are encoded by multigene families that consist of processed pseudogenes and one functional intron-containing gene within their coding regions. Ribosomal Protein S20, also known as RPS20, is a 119 amino acid cytoplasmic protein that is a component of the 40S ribosomal subunit. Co-transcribed with the small nucleolar RNA gene U54, Ribosomal Protein S20 is a primary binding protein (it binds independently to its target protein) that interacts with both the 5' and 3' minor domains of 16S ribosomal RNA (rRNA). Through its interactions with 16S rRNA, Ribosomal Protein S20 is thought to play a key role in nucleating the assembly of the 30S ribosomal subunit. Like most ribosomal protein-coding genes, the gene encoding Ribosomal Protein S20 is dispersed throughout the genome and exists as multiple processed pseudogenes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPS20