RPS12 Antibody

Images

 
Immunohistochemistry-Paraffin: RPS12 Antibody [NBP1-80805] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of reaction center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPS12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AAGGVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDV
Specificity
Specificity of human RPS12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RPS12 Protein (NBP1-80805PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPS12 Antibody

  • ribosomal protein S12,40S ribosomal protein S12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-22288
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-97620
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84847
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
NBP1-80961
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-75649
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-36751
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-93953
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-73636
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, CyTOF-ready

Publications for RPS12 Antibody (NBP1-80805) (0)

There are no publications for RPS12 Antibody (NBP1-80805).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS12 Antibody (NBP1-80805) (0)

There are no reviews for RPS12 Antibody (NBP1-80805). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RPS12 Antibody (NBP1-80805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPS12 Products

Bioinformatics Tool for RPS12 Antibody (NBP1-80805)

Discover related pathways, diseases and genes to RPS12 Antibody (NBP1-80805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS12 Antibody (NBP1-80805)

Discover more about diseases related to RPS12 Antibody (NBP1-80805).
 

Pathways for RPS12 Antibody (NBP1-80805)

View related products by pathway.

PTMs for RPS12 Antibody (NBP1-80805)

Learn more about PTMs related to RPS12 Antibody (NBP1-80805).
 

Research Areas for RPS12 Antibody (NBP1-80805)

Find related products by research area.

Blogs on RPS12

There are no specific blogs for RPS12, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS12
Entrez
Uniprot