RPL39L Antibody (4A8-1B6)


Western Blot: RPL39L Antibody (4A8-1B6) [H00116832-M01] - RPL39L monoclonal antibody (M01), clone 4A8-1B6 Analysis of RPL39L expression in HL-60.
Immunohistochemistry-Paraffin: RPL39L Antibody (4A8-1B6) [H00116832-M01] - Analysis of monoclonal antibody to RPL39L on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. Antibody concentration 1 ...read more
Sandwich ELISA: RPL39L Antibody (4A8-1B6) [H00116832-M01] - Detection limit for recombinant GST tagged RPL39L is approximately 0.1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA

Order Details

RPL39L Antibody (4A8-1B6) Summary

RPL39L (AAH12328, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
RPL39L - ribosomal protein L39-like
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPL39L Antibody (4A8-1B6)

  • 60S ribosomal protein L39-like
  • L39-2
  • ribosomal protein L39-like 1,60S ribosomal protein L39-2
  • ribosomal protein L39-like protein
  • ribosomal protein L39-like
  • RPL39L1


This gene encodes a protein sharing high sequence similarity with ribosomal protein L39. Although the name of this gene has been referred to as 'ribosomal protein L39' in the public databases, its official name is 'ribosomal protein L39-like'. It is not currently known whether the encoded protein is a functional ribosomal protein or whether it has evolved a function that is independent of the ribosome.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for RPL39L Antibody (H00116832-M01) (0)

There are no publications for RPL39L Antibody (H00116832-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL39L Antibody (H00116832-M01) (0)

There are no reviews for RPL39L Antibody (H00116832-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL39L Antibody (H00116832-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RPL39L Products

Bioinformatics Tool for RPL39L Antibody (H00116832-M01)

Discover related pathways, diseases and genes to RPL39L Antibody (H00116832-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL39L Antibody (H00116832-M01)

Discover more about diseases related to RPL39L Antibody (H00116832-M01).

Pathways for RPL39L Antibody (H00116832-M01)

View related products by pathway.

PTMs for RPL39L Antibody (H00116832-M01)

Learn more about PTMs related to RPL39L Antibody (H00116832-M01).

Research Areas for RPL39L Antibody (H00116832-M01)

Find related products by research area.

Blogs on RPL39L

There are no specific blogs for RPL39L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RPL39L Antibody (4A8-1B6) and receive a gift card or discount.


Gene Symbol RPL39L