RPL39L Antibody (4A8-1B6)

Western Blot: RPL39L Antibody (4A8-1B6) [H00116832-M01] - RPL39L monoclonal antibody (M01), clone 4A8-1B6 Analysis of RPL39L expression in HL-60.

Immunohistochemistry-Paraffin: RPL39L Antibody (4A8-1B6) [H00116832-M01] - Analysis of monoclonal antibody to RPL39L on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. Antibody concentration 1 ug/ml.

Sandwich ELISA: RPL39L Antibody (4A8-1B6) [H00116832-M01] - Detection limit for recombinant GST tagged RPL39L is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 4A8-1B6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

RPL39L Antibody (4A8-1B6) Summary

• Immunogen: RPL39L (AAH12328, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
• Specificity: RPL39L - ribosomal protein L39-like
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RPL39L
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPL39L Antibody (4A8-1B6)

• 60S ribosomal protein L39-like
• L39-2
• ribosomal protein L39-like 1,60S ribosomal protein L39-2
• ribosomal protein L39-like protein
• ribosomal protein L39-like
• RPL39L1

Background

This gene encodes a protein sharing high sequence similarity with ribosomal protein L39. Although the name of this gene has been referred to as 'ribosomal protein L39' in the public databases, its official name is 'ribosomal protein L39-like'. It is not currently known whether the encoded protein is a functional ribosomal protein or whether it has evolved a function that is independent of the ribosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPL39L
• Entrez:
  • 116832(Human)
• OMIM:
  • 607547(Human)
• Uniprot:
  • AAH12328(Human)