UBL4B Antibody

Western Blot: UBL4B Antibody [NBP1-82054] - Analysis in control (vector only transfected HEK293T lysate) and UBL4B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: UBL4B Antibody [NBP1-82054] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: UBL4B Antibody [NBP1-82054] - Staining in human testis and endometrium tissues using anti-UBL4B antibody. Corresponding UBL4B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: UBL4B Antibody [NBP1-82054] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

UBL4B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBL4B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UBL4B Protein (NBP1-82054PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UBL4B Antibody

• FLJ25690
• ubiquitin-like 4B
• ubiquitin-like protein 4B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBL4B