![Immunocytochemistry/Immunofluorescence: RPL10L Antibody (1E9) [H00140801-M01] - Analysis of monoclonal antibody to RPL10L on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/RPL10L-Antibody-1E9-Immunocytochemistry-Immunofluorescence-H00140801-M01-img0002.jpg "Immunocytochemistry/Immunofluorescence: RPL10L Antibody (1E9) [H00140801-M01] - Analysis of monoclonal antibody to RPL10L on HeLa cell . Antibody concentration 10 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | ELISA, ICC/IF |
| Clone | 1E9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | RPL10L (NP_542784.1, 115 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRGAFGKPQGTVARVHIGQVIMSIRTKLQNEEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAKKCLIPDGCGVKYVPSHGPLDKWRVLHS |
| Specificity | Reacts with ribosomal protein L10-like. |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RPL10L |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against recombinant protein in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![ELISA: RPL10L Antibody (1E9) [H00140801-M01] - Detection limit for recombinant GST tagged RPL10L is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/RPL10L-Antibody-1E9-Sandwich-ELISA-H00140801-M01-img0003.jpg "ELISA: RPL10L Antibody (1E9) [H00140801-M01] - Detection limit for recombinant GST tagged RPL10L is 0.3 ng/ml as a capture antibody.")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")