RPL35 Antibody - Azide and BSA Free

Western Blot: RPL35 Antibody [NBP3-15546] - Western blot analysis of extracts of various cell lines, using RPL35 Rabbit pAb (NBP3-15546) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunocytochemistry/Immunofluorescence: RPL35 Antibody [NBP3-15546] - Immunofluorescence analysis of L929 cells using RPL35 antibody (NBP3-15546) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: RPL35 Antibody [NBP3-15546] - Immunohistochemistry of paraffin-embedded Human colon carcinoma using RPL35 Rabbit pAb (NBP3-15546) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RPL35 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit RPL35 Antibody - Azide and BSA Free (NBP3-15546) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human RPL35 (NP_009140.1). VRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPL35
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for RPL35 Antibody - Azide and BSA Free

• M
• ribosomal protein L35,60S ribosomal protein L35

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: RPL35