RPL23A Antibody (3E11.)

Images

 
Western Blot: RPL23A Antibody (3E11) [H00006147-M10] - Analysis of RPL23A expression in HeLa.
Immunocytochemistry/ Immunofluorescence: RPL23A Antibody (3E11) [H00006147-M10] - Analysis of monoclonal antibody to RPL23A on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: RPL23A Antibody (3E11) [H00006147-M10] - Analysis of RPL23A expression in transfected 293T cell line by RPL23A monoclonal antibody (M10), clone 3E11. Lane 1: RPL23A transfected lysatE (17.7 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3E11.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPL23A Antibody (3E11.) Summary

Immunogen
RPL23A (NP_000975.2, 59 a.a. - 156 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII
Specificity
Reacts with ribosomal protein L23a.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPL23A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPL23A Antibody (3E11.)

  • 60S ribosomal protein L23a
  • FLJ27455
  • MDA20
  • melanoma differentiation-associated gene 20
  • ribosomal protein L23a

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L23P family of ribosomal proteins. It is located in the cytoplasm. The protein may be one of the target molecules involved in mediating growth inhibition by interferon. In yeast, the corresponding protein binds to a specific site on the 26S rRNA. This gene is co-transcribed with the U42A, U42B, U101A, and U101B small nucleolar RNA genes, which are located in its third, first, second, and fourth introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06069
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-47297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006143-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
H00006147-M10
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RPL23A Antibody (H00006147-M10) (0)

There are no publications for RPL23A Antibody (H00006147-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL23A Antibody (H00006147-M10) (0)

There are no reviews for RPL23A Antibody (H00006147-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPL23A Antibody (H00006147-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL23A Products

Bioinformatics Tool for RPL23A Antibody (H00006147-M10)

Discover related pathways, diseases and genes to RPL23A Antibody (H00006147-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL23A Antibody (H00006147-M10)

Discover more about diseases related to RPL23A Antibody (H00006147-M10).
 

Pathways for RPL23A Antibody (H00006147-M10)

View related products by pathway.

PTMs for RPL23A Antibody (H00006147-M10)

Learn more about PTMs related to RPL23A Antibody (H00006147-M10).

Blogs on RPL23A

There are no specific blogs for RPL23A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL23A Antibody (3E11.) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL23A
Entrez
Uniprot