RPL13 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

RPL13 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPL13.
  
  

  Source: E. coli

  Amino Acid Sequence: PKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: RPL13
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13250.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RPL13 Recombinant Protein Antigen

• BBC1FLJ27454
• Breast basic conserved protein 1
• D16S444E
• FLJ27453
• MGC117342
• MGC71373,60S ribosomal protein L13
• OK/SW-cl.46
• ribosomal protein L13

Background

RPL13, also known as 60S ribosomal protein L13, is a 24kDa 211 amino acid protein with a shorter 19kDA 164 isoform produced by alternative splicing. RPL13 belongs to the L13E family of ribosomal proteins and can be found in the cytoplasm. Current research is being conducted on RPL13 in relation to Smith-Magenis syndrome, Treacher Collins syndrome, breast carcinoma, carcinoma, skin atrophy, prostate cancer, prostatitis, schizophrenia and malaria. RPL13 has been linked to the reverse transcription, ribosome assembly, cell division, DNA protection and pigmentation pathways where it interacts with RPL4, RPL8, RPS3, SMN1 and RPL12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPL13