RPGRIP1L Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RPGRIP1L Antibody [NBP2-57686] - Staining of human cell line A549 shows localization to plasma membrane & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPGRIP1L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RPGRIP1L Antibody - BSA Free (NBP2-57686) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TKYGNSLLEEARGEIRNLENVIQSQRGQIEELEHLAEILKTQLRRKENEIELSLLQLREQQATDQRSNIRDNVEMIKLHKQLVEKSNALSAMEGKFIQLQEKQRTLRIS
• Predicted Species: Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPGRIP1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPGRIP1L Recombinant Protein Antigen (NBP2-57686PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RPGRIP1L Antibody - BSA Free

• CORS3
• FTMDKFZp686C0668
• JBTS7fantom homolog
• KIAA1005RPGRIP1-like protein
• MKS5nephrocystin 8
• NPHP8
• protein fantom
• RPGR-interacting protein 1-like protein
• RPGRIP1-like

Background

RPGRIP1L is encoded by this gene can localize to the basal body-centrosome complex or to primary cilia and centrosomes in ciliated cells. The encoded protein has been found to interact with nephrocystin-4. Defects in this gene are a cause of Joubert syndrome type 7 (JBTS7) and Meckel syndrome type 5 (MKS5). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPGRIP1L