ROR alpha/NR1F1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ROR alpha/NR1F1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ROR alpha/NR1F1
  
  

  Source: E.coli

  Amino Acid Sequence: VQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: RORA
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25112It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ROR alpha/NR1F1 Recombinant Protein Antigen

• DKFZp686M2414
• MGC119326
• NR1F1
• NR1F1MGC119329
• nuclear receptor ROR-alpha
• Nuclear receptor RZR-alpha
• Nuclear receptor subfamily 1 group F member 1
• RAR-related orphan receptor A
• RAR-related orphan receptor alpha
• retinoic acid receptor-related orphan receptor alpha
• retinoid-related orphan receptor alpha
• Retinoid-related orphan receptor-alpha
• ROR alpha
• ROR1
• ROR2
• ROR3
• RORA
• RZRA
• RZR-ALPHA
• RZRAROR-alpha
• transcription factor RZR-alpha

Background

Retinoid related orphan receptor alpha (ROR alpha) is a NR1 Thyroid Hormone Like Receptor. To date, ROR alpha, beta, and gamma subtypes have been discovered. ROR alpha has been shown to affect the development of the central nervous system. Deletion of ROR alpha in mice causes severe impairment in the differentiation of cerebellar Purkinje neurons and results in the "staggerer" phenotype. ROR alpha has been suggested as a potential target in the treatment of chronic inflammatory diseases, including atherosclerosis and rheumatoid arthritis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RORA