ROR alpha/NR1F1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RORA(RAR-related orphan receptor A) The peptide sequence was selected from the middle region of RORA.
Peptide sequence PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI. |
| Predicted Species |
Porcine (100%), Bovine (100%), Rabbit (100%), Canine (100%), Goat (100%), Equine (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RORA |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Western Blot 1:100-1:2000
|
| Application Notes |
This is a rabbit polyclonal antibody against RORA and was validated on Western blot. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ROR alpha/NR1F1 Antibody
Background
The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Publications for ROR alpha/NR1F1 Antibody (NBP1-52829) (0)
There are no publications for ROR alpha/NR1F1 Antibody (NBP1-52829).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ROR alpha/NR1F1 Antibody (NBP1-52829) (0)
There are no reviews for ROR alpha/NR1F1 Antibody (NBP1-52829).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ROR alpha/NR1F1 Antibody (NBP1-52829) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ROR alpha/NR1F1 Products
Blogs on ROR alpha/NR1F1