ROR alpha/NR1F1 Antibody

Images

 
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52829] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: ROR alpha/NR1F1 Antibody [NBP1-52829] - Human Pineal Tissue Observed Staining: Nucleus in Human Pineal Tissue Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary ...read more

Product Details

Summary
Product Discontinued
View other related ROR alpha/NR1F1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52829
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ROR alpha/NR1F1 Antibody Summary

Immunogen
Synthetic peptides corresponding to RORA(RAR-related orphan receptor A) The peptide sequence was selected from the middle region of RORA. Peptide sequence PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI.
Clonality
Polyclonal
Host
Rabbit
Gene
RORA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against RORA and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ROR alpha/NR1F1 Antibody

  • DKFZp686M2414
  • MGC119326
  • NR1F1
  • NR1F1MGC119329
  • nuclear receptor ROR-alpha
  • Nuclear receptor RZR-alpha
  • Nuclear receptor subfamily 1 group F member 1
  • RAR-related orphan receptor A
  • RAR-related orphan receptor alpha
  • retinoic acid receptor-related orphan receptor alpha
  • retinoid-related orphan receptor alpha
  • Retinoid-related orphan receptor-alpha
  • ROR alpha
  • ROR1
  • ROR2
  • ROR3
  • RORA
  • RZRA
  • RZR-ALPHA
  • RZRAROR-alpha
  • transcription factor RZR-alpha

Background

The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

645-WN/CF
Species: Hu, Mu
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
AF4649
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF1120
Species: Mu
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
AF1617
Species: Hu
Applications: WB
H00009572-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1927
Species: Hu
Applications: WB, IP, ICC
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF198
Species: Mu
Applications: WB, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7164
Species: Hu
Applications: WB
AF6278
Species: Hu, Mu
Applications: WB

Publications for ROR alpha/NR1F1 Antibody (NBP1-52829) (0)

There are no publications for ROR alpha/NR1F1 Antibody (NBP1-52829).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROR alpha/NR1F1 Antibody (NBP1-52829) (0)

There are no reviews for ROR alpha/NR1F1 Antibody (NBP1-52829). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ROR alpha/NR1F1 Antibody (NBP1-52829) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ROR alpha/NR1F1 Products

Bioinformatics Tool for ROR alpha/NR1F1 Antibody (NBP1-52829)

Discover related pathways, diseases and genes to ROR alpha/NR1F1 Antibody (NBP1-52829). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROR alpha/NR1F1 Antibody (NBP1-52829)

Discover more about diseases related to ROR alpha/NR1F1 Antibody (NBP1-52829).
 

Pathways for ROR alpha/NR1F1 Antibody (NBP1-52829)

View related products by pathway.

PTMs for ROR alpha/NR1F1 Antibody (NBP1-52829)

Learn more about PTMs related to ROR alpha/NR1F1 Antibody (NBP1-52829).
 

Research Areas for ROR alpha/NR1F1 Antibody (NBP1-52829)

Find related products by research area.

Blogs on ROR alpha/NR1F1

There are no specific blogs for ROR alpha/NR1F1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROR alpha/NR1F1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RORA
Entrez
Uniprot