RNF32 Antibody - Azide and BSA Free

Western Blot: RNF32 Antibody [H00140545-D01P] - Analysis of RNF32 expression in mouse kidney.

Immunoprecipitation: RNF32 Antibody [H00140545-D01P] - Analysis of RNF32 transfected lysate using anti-RNF32 rabbit polyclonal antibody and Protein Magnetic Bead, and immunoblotted with RNF32 purified mouse polyclonal antibody (B01P).

• Reactivity: Hu, Mu
• Applications: WB, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RNF32 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit RNF32 Antibody - Azide and BSA Free (H00140545-D01P) is a polyclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RNF32 (AAH28120.1, 1 a.a. - 256 a.a.) full-length human protein. MLKNKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAIIDTGLKKTTQCPKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQGDSVQPCPICKEEFELRPQVLLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGCVVRKWYRNLRKTVPPTDAKLRKNSLKKSSQKSATASCAHTTPTLKSSLQKSISAWP
• Specificity: Reacts with ring finger protein 32.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF32
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF32 Antibody - Azide and BSA Free

• FKSG33
• HSD15
• ring finger protein 32

Background

The protein encoded by this gene contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. This gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids. Several alternatively spliced transcript variants exist, but their full length natures are not clear. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF32
• Entrez:
  • 140545(Human)