RNF26 Antibody (5B9) - Azide and BSA Free

Western Blot: RNF26 Antibody (5B9) [H00079102-M01] - Analysis of RNF26 expression in transfected 293T cell line by RNF26 monoclonal antibody (M01), clone 5B9.Lane 1: RNF26 transfected lysate(47.737 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5B9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RNF26 Antibody (5B9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RNF26 Antibody (5B9) - Azide and BSA Free (H00079102-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RNF26 (NP_114404, 344 a.a. ~ 433 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TIRVTPVRGRERLNEEEPPGGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRGILQTLNVYL
• Specificity: RNF26 - ring finger protein 26
• Isotype: IgG3 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RNF26
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF26 Antibody (5B9) - Azide and BSA Free

• MGC2642
• ring finger protein 26
• ring finger protein with leucine zipper

Background

The protein encoded by this intronless gene contains a C3HC5 type of RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. The expression of this gene was found to be upregulated in cancer cell lines derived from different types of cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF26
• Entrez:
  • 79102(Human)
• OMIM:
  • 606130(Human)
• Uniprot:
  • NP_114404(Human)