RNF213 Antibody (5C12)

Images

 
There are currently no images for RNF213 Antibody (H00057674-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNF213 Antibody (5C12) Summary

Immunogen
C17orf27 (NP_065965, 2016 a.a. ~ 2113 a.a) partial recombinant protein with GST tag.LSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEE RFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCVS VWKTAAVLKWNRE
Specificity
C17orf27 - chromosome 17 open reading frame 27
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RNF213
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF213 Antibody (5C12)

  • ALK lymphoma oligomerization partner on chromosome 17
  • C17orf27
  • chromosome 17 open reading frame 27
  • DKFZp762N1115
  • FLJ13051
  • KIAA1554MGC46622
  • KIAA1618
  • MGC9929
  • NET57
  • protein ALO17
  • ring finger protein 213

Background

C17orf27 contains 1 RING-type zinc finger.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
AF7250
Species: Hu
Applications: IHC
AF4210
Species: Hu
Applications: WB, IHC
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55515
Species: Hu
Applications: ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-55053
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057674-M01
Species: Hu
Applications: WB, ELISA

Publications for RNF213 Antibody (H00057674-M01) (0)

There are no publications for RNF213 Antibody (H00057674-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF213 Antibody (H00057674-M01) (0)

There are no reviews for RNF213 Antibody (H00057674-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF213 Antibody (H00057674-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF213 Products

Bioinformatics Tool for RNF213 Antibody (H00057674-M01)

Discover related pathways, diseases and genes to RNF213 Antibody (H00057674-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF213 Antibody (H00057674-M01)

Discover more about diseases related to RNF213 Antibody (H00057674-M01).
 

Pathways for RNF213 Antibody (H00057674-M01)

View related products by pathway.

PTMs for RNF213 Antibody (H00057674-M01)

Learn more about PTMs related to RNF213 Antibody (H00057674-M01).
 

Research Areas for RNF213 Antibody (H00057674-M01)

Find related products by research area.

Blogs on RNF213

There are no specific blogs for RNF213, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF213 Antibody (5C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF213
Entrez