Recombinant Human RNF168 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RNF168 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 462-571 of Human RNF168

Source: Wheat Germ

Amino Acid Sequence: MVPNRQKGSPDEYHLRATSSPPDKVLNGQRKNPKDGNFKRQTHTKHPTPERGSRDKNRQVSLKMQLKQSVNRRKMPNSTRDHCKVSKSAHSLQPSISQKSVFQMFQRCTK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RNF168
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF168 Protein

  • E3 ubiquitin-protein ligase RNF168
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ39749
  • ring finger protein 168FLJ35794
  • RNF168

Background

RNF168 - ring finger protein 168

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, KO
H00009025-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NB100-395
Species: Hu, Mu
Applications: IP (-), WB, ICC/IF, IP, PLA
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-83670
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00165918-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for RNF168 Partial Recombinant Protein (H00165918-Q01) (0)

There are no publications for RNF168 Partial Recombinant Protein (H00165918-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF168 Partial Recombinant Protein (H00165918-Q01) (0)

There are no reviews for RNF168 Partial Recombinant Protein (H00165918-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF168 Partial Recombinant Protein (H00165918-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF168 Products

Bioinformatics Tool for RNF168 Partial Recombinant Protein (H00165918-Q01)

Discover related pathways, diseases and genes to RNF168 Partial Recombinant Protein (H00165918-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF168 Partial Recombinant Protein (H00165918-Q01)

Discover more about diseases related to RNF168 Partial Recombinant Protein (H00165918-Q01).
 

Pathways for RNF168 Partial Recombinant Protein (H00165918-Q01)

View related products by pathway.

PTMs for RNF168 Partial Recombinant Protein (H00165918-Q01)

Learn more about PTMs related to RNF168 Partial Recombinant Protein (H00165918-Q01).
 

Research Areas for RNF168 Partial Recombinant Protein (H00165918-Q01)

Find related products by research area.

Blogs on RNF168

There are no specific blogs for RNF168, but you can read our latest blog posts.

Customers Who Bought This Also Bought

53BP1 Antibody
NB100-304
ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF168 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF168
Entrez