RNF165 Antibody

Images

 
Western Blot: RNF165 Antibody [NBP1-70696] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: RNF165 Antibody [NBP1-70696] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF165 Antibody Summary

Immunogen
Synthetic peptides corresponding to RNF165(ring finger protein 165) The peptide sequence was selected from the middle region of RNF165. Peptide sequence SSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF165
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNF165 Antibody

  • ARKL2
  • ring finger protein 165

Background

RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00027130-P02
Species: Hu
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-81362
Species: Hu
Applications: IHC, IHC-P
NBP1-57595
Species: Hu
Applications: WB
NBP1-70696
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RNF165 Antibody (NBP1-70696) (0)

There are no publications for RNF165 Antibody (NBP1-70696).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF165 Antibody (NBP1-70696) (0)

There are no reviews for RNF165 Antibody (NBP1-70696). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF165 Antibody (NBP1-70696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF165 Products

Bioinformatics Tool for RNF165 Antibody (NBP1-70696)

Discover related pathways, diseases and genes to RNF165 Antibody (NBP1-70696). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RNF165

There are no specific blogs for RNF165, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF165 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF165