Recombinant Human RNF144A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RNF144A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-292 of Human RNF144 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTTARYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQHVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLRDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCPESLDDDFLLIHCDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT

Protein/Peptide Type
Recombinant Protein
Gene
RNF144A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF144A Protein

  • EC 6.3.2
  • EC 6.3.2.-
  • KIAA0161UBCE7IP4probable E3 ubiquitin-protein ligase RNF144A
  • ring finger protein 144Aring finger protein 144
  • RNF144
  • UbcM4-interacting protein 4
  • ubiquitin conjugating enzyme 7 interacting protein 4
  • Ubiquitin-conjugating enzyme 7-interacting protein 4

Background

RNF144( AAH50373, 1 a.a. - 293 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004212-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-260
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-83549
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-14967
Species: Hu
Applications: WB, IP
NBP1-94029
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
AF5627
Species: Mu
Applications: WB
NBP1-59195
Species: Hu, Mu
Applications: WB, ICC/IF
AF5286
Species: Hu
Applications: WB
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB944
Species: Hu
Applications: WB, IHC
NLS1729
Species: Hu, Eq
Applications: WB, IHC-P
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-59944
Species: Hu
Applications: WB, ICC/IF
NBP2-24724
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB
H00009781-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for RNF144A Recombinant Protein (H00009781-P01) (0)

There are no publications for RNF144A Recombinant Protein (H00009781-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF144A Recombinant Protein (H00009781-P01) (0)

There are no reviews for RNF144A Recombinant Protein (H00009781-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF144A Recombinant Protein (H00009781-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF144A Products

Bioinformatics Tool for RNF144A Recombinant Protein (H00009781-P01)

Discover related pathways, diseases and genes to RNF144A Recombinant Protein (H00009781-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF144A Recombinant Protein (H00009781-P01)

Discover more about diseases related to RNF144A Recombinant Protein (H00009781-P01).
 

Pathways for RNF144A Recombinant Protein (H00009781-P01)

View related products by pathway.

Research Areas for RNF144A Recombinant Protein (H00009781-P01)

Find related products by research area.

Blogs on RNF144A

There are no specific blogs for RNF144A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MED12 Antibody
NB100-2357
RNF144A Antibody
H00009781-B02P
NCOA6 Antibody
NB200-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF144A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF144A