Recombinant Human RNF135 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RNF135 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-210 of Human RNF135 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
RNF135
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
49.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF135 GST (N-Term) Protein

  • E3 ubiquitin-protein ligase RNF135
  • EC 6.3.2.-
  • MGC13061
  • REUL
  • ring finger protein 135RIG-I E3 ubiquitin ligase
  • Riplet

Background

The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00029956-M01A
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP2-20214
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00006124-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
H00058516-B02P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-97838
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-88192
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-13252
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-92441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-13045
Species: Hu
Applications: ICC/IF, WB
MAB8164
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP1-06069
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-20210
Species: Hu, I, Mu
Applications: IHC, IHC-P, WB
NBP1-57476
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB7158
Species: Hu, Mu
Applications: IHC, WB
NBP2-13251
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RNF135 Recombinant Protein (H00084282-P01) (0)

There are no publications for RNF135 Recombinant Protein (H00084282-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF135 Recombinant Protein (H00084282-P01) (0)

There are no reviews for RNF135 Recombinant Protein (H00084282-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF135 Recombinant Protein (H00084282-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF135 Products

Bioinformatics Tool for RNF135 Recombinant Protein (H00084282-P01)

Discover related pathways, diseases and genes to RNF135 Recombinant Protein (H00084282-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF135 Recombinant Protein (H00084282-P01)

Discover more about diseases related to RNF135 Recombinant Protein (H00084282-P01).
 

Pathways for RNF135 Recombinant Protein (H00084282-P01)

View related products by pathway.

PTMs for RNF135 Recombinant Protein (H00084282-P01)

Learn more about PTMs related to RNF135 Recombinant Protein (H00084282-P01).
 

Research Areas for RNF135 Recombinant Protein (H00084282-P01)

Find related products by research area.

Blogs on RNF135

There are no specific blogs for RNF135, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPL7 Antibody
NB100-2269
RPL22 Antibody
NBP1-06069

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF135 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF135