RNF13 Antibody - BSA Free

Western Blot: RNF13 Antibody [NBP2-88161] - WB Suggested Anti-RNF13 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Hela cell lysateRNF13 is supported by BioGPS gene expression data to be expressed in HeLa

Western Blot: RNF13 Antibody [NBP2-88161] - Host: Rabbit. Target Name: RNF13. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RNF13 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF13. Peptide sequence: ILAYNFENASQTFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RNF13 Antibody - BSA Free

• EC 6.3.2.-
• FLJ93817
• MGC13689
• ring finger protein 13E3 ubiquitin-protein ligase RNF13
• RZFRING zinc finger protein

Background

RNF13 is encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. The specific function of this gene has not yet been determined. Alternatively spliced transcript variants that encode the same protein have been reported. A pseudogene, which is also located on chromosome 3, has been defined for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF13