RNF125 Antibody (1A5)

Sandwich ELISA: RNF125 Antibody (1A5) [H00054941-M01] - Detection limit for recombinant GST tagged RNF125 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, S-ELISA
• Clone: 1A5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

RNF125 Antibody (1A5) Summary

• Immunogen: RNF125 (NP_060301, 143 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNT
• Specificity: RNF125 - ring finger protein 125
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RNF125
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF125 Antibody (1A5)

• E3 ubiquitin-protein ligase RNF125
• EC 6.3.2.-
• FLJ20456
• MGC21737
• ring finger protein 125TRAC1
• T-cell RING activation protein 1
• T-cell ring protein identified in activation screen
• TRAC-1

Background

This gene encodes a novel E3 ubiquitin ligase that contains an N-terminal RING finger domain. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF125
• Entrez:
  • 54941(Human)
• Uniprot:
  • NP_060301(Human)