RNF125 Antibody (1A5)

Images

 
Sandwich ELISA: RNF125 Antibody (1A5) [H00054941-M01] - Detection limit for recombinant GST tagged RNF125 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNF125 Antibody (1A5) Summary

Immunogen
RNF125 (NP_060301, 143 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNT
Specificity
RNF125 - ring finger protein 125
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RNF125
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF125 Antibody (1A5)

  • E3 ubiquitin-protein ligase RNF125
  • EC 6.3.2.-
  • FLJ20456
  • MGC21737
  • ring finger protein 125TRAC1
  • T-cell RING activation protein 1
  • T-cell ring protein identified in activation screen
  • TRAC-1

Background

This gene encodes a novel E3 ubiquitin ligase that contains an N-terminal RING finger domain. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27419
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NB100-58824
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IP, WB
NB110-1244
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA
NBP1-87204
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NBP1-85348
Species: Hu
Applications: IHC, IHC-P, WB
UL-553
Species: Hu
Applications: EnzAct
NBP1-04351
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP2-88163
Species: Hu
Applications: WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
H00054941-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for RNF125 Antibody (H00054941-M01) (0)

There are no publications for RNF125 Antibody (H00054941-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF125 Antibody (H00054941-M01) (0)

There are no reviews for RNF125 Antibody (H00054941-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF125 Antibody (H00054941-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF125 Products

Array H00054941-M01

Bioinformatics Tool for RNF125 Antibody (H00054941-M01)

Discover related pathways, diseases and genes to RNF125 Antibody (H00054941-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF125 Antibody (H00054941-M01)

Discover more about diseases related to RNF125 Antibody (H00054941-M01).
 

Pathways for RNF125 Antibody (H00054941-M01)

View related products by pathway.

PTMs for RNF125 Antibody (H00054941-M01)

Learn more about PTMs related to RNF125 Antibody (H00054941-M01).
 

Research Areas for RNF125 Antibody (H00054941-M01)

Find related products by research area.

Blogs on RNF125

There are no specific blogs for RNF125, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF125 Antibody (1A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF125
Entrez
Uniprot