RNASEH2C Antibody

Immunocytochemistry/Immunofluorescence: RNASEH2C Antibody [NBP2-56902] - Staining of human cell line MCF7 shows localization to nucleus.

Product Discontinued

RNASEH2C Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNASEH2C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RNASEH2C Recombinant Protein Antigen (NBP2-56902PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RNASEH2C Antibody

• AGS3RNase H2 subunit C
• Aicardi-Goutieres syndrome 3 protein
• AYP1FLJ20974
• MGC22934
• ribonuclease H2 subunit C
• ribonuclease H2, subunit C
• Ribonuclease HI subunit C
• RNase H1 small subunit

Background

The RNASEH2C gene encodes a ribonuclease H subunit that can cleave ribonucleotides from RNA:DNA duplexes. Mutations in this gene cause Aicardi-Goutieres syndrome-3, a disease that causes severe neurologic dysfunction. A pseudogene for this gene has been identifie

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNASEH2C