RNASEH2C Antibody

Images

 
Western Blot: RNASEH2C Antibody [NBP2-56902] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: RNASEH2C Antibody [NBP2-56902] - Staining of human cell line MCF7 shows localization to nucleus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNASEH2C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVM
Specificity
Specificity of human RNASEH2C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNASEH2C
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNASEH2C Recombinant Protein Antigen (NBP2-56902PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RNASEH2C Antibody

  • AGS3RNase H2 subunit C
  • Aicardi-Goutieres syndrome 3 protein
  • AYP1FLJ20974
  • MGC22934
  • ribonuclease H2 subunit C
  • ribonuclease H2, subunit C
  • Ribonuclease HI subunit C
  • RNase H1 small subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29617
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-02004
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP1-58235
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, KO
NBP1-77082
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-14258
Species: Hu, Mu, Rt
Applications: WB
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83002
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-90980
Species: Hu
Applications: IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-56902
Species: Hu
Applications: WB, ICC/IF

Publications for RNASEH2C Antibody (NBP2-56902) (0)

There are no publications for RNASEH2C Antibody (NBP2-56902).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNASEH2C Antibody (NBP2-56902) (0)

There are no reviews for RNASEH2C Antibody (NBP2-56902). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNASEH2C Antibody (NBP2-56902) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RNASEH2C Antibody (NBP2-56902)

Discover related pathways, diseases and genes to RNASEH2C Antibody (NBP2-56902). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNASEH2C Antibody (NBP2-56902)

Discover more about diseases related to RNASEH2C Antibody (NBP2-56902).
 

Pathways for RNASEH2C Antibody (NBP2-56902)

View related products by pathway.

Blogs on RNASEH2C

There are no specific blogs for RNASEH2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNASEH2C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASEH2C