RKIP/PBP Antibody (M2)

Images

 
Western Blot: RKIP/PBP Antibody (M2) [H00005037-M05] - Analysis of PBP expression in HeLa (Cat # L013V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
M2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RKIP/PBP Antibody (M2) Summary

Immunogen
PBP (AAH31102, 1 a.a. ~ 187 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
Localization
Cytoplasmic
Specificity
PBP - prostatic binding protein
Isotype
IgG
Clonality
Monoclonal
Host
Mouse
Gene
PEBP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RKIP/PBP Antibody (M2)

  • HCNP
  • HCNPpp
  • hippocampal cholinergic neurostimulating peptide
  • Neuropolypeptide h3
  • PBP
  • PBPPEBP-1
  • PEBP1
  • PEBP-1
  • PEBPHCNPpp
  • phosphatidylethanolamine binding protein 1
  • phosphatidylethanolamine-binding protein 1
  • prostatic binding protein
  • Prostatic-binding protein
  • Raf kinase inhibitory protein
  • RKIP
  • RKIPRaf kinase inhibitor protein

Background

PBP, also known as RKIP (RAF kinase inhibitor protein), binds ATP, opioids and phosphatidylethanolamine. PBP is able to regulate Aurora kinase B expression and the spindle checkpoint through interaction with the RAF1/MEK/ERK cascade. PBP is able to bind to RAF1 and MEK and competitively disrupt the interaction between these proteins. PBP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. It increases the production of choline acetyltransferase but not acetylcholinesterase. PBP has been implicated as a suppressor of metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-82956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4218
Species: Hu
Applications: WB, IHC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF5520
Species: Hu, Mu
Applications: WB
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-99205
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005037-M05
Species: Hu
Applications: WB, ELISA

Publications for RKIP/PBP Antibody (H00005037-M05) (0)

There are no publications for RKIP/PBP Antibody (H00005037-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RKIP/PBP Antibody (H00005037-M05) (0)

There are no reviews for RKIP/PBP Antibody (H00005037-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RKIP/PBP Antibody (H00005037-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RKIP/PBP Products

Bioinformatics Tool for RKIP/PBP Antibody (H00005037-M05)

Discover related pathways, diseases and genes to RKIP/PBP Antibody (H00005037-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RKIP/PBP Antibody (H00005037-M05)

Discover more about diseases related to RKIP/PBP Antibody (H00005037-M05).
 

Pathways for RKIP/PBP Antibody (H00005037-M05)

View related products by pathway.

PTMs for RKIP/PBP Antibody (H00005037-M05)

Learn more about PTMs related to RKIP/PBP Antibody (H00005037-M05).
 

Research Areas for RKIP/PBP Antibody (H00005037-M05)

Find related products by research area.

Blogs on RKIP/PBP

There are no specific blogs for RKIP/PBP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RKIP/PBP Antibody (M2) and receive a gift card or discount.

Bioinformatics

Gene Symbol PEBP1
Entrez
OMIM
Uniprot