Rit2 Antibody (3F2)

Images

 
Sandwich ELISA: Rit2 Antibody (3F2) [H00006014-M01] - Detection limit for recombinant GST tagged RIT2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Rit2 Antibody (3F2) Summary

Immunogen
RIT2 (AAH18060, 1 a.a. ~ 217 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLKKKRENMT
Localization
Plasma membrane
Specificity
RIT2 - Ras-like without CAAX 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RIT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rit2 Antibody (3F2)

  • GTP-binding protein Rit2
  • GTP-binding protein Roc2
  • Ras-like protein expressed in neurons
  • Ras-like without CAAX 2
  • Ras-like without CAAX protein 2
  • RIBA
  • Ric (Drosophila)-like, expressed in neurons
  • Ric-like, expressed in neurons
  • RIN
  • Rit2
  • ROC2

Background

The Ras super-family comprises a group of structurally related low molecular weight (20-30 kDa) proteins, which bind GTP or GDP and exhibit a low intrinsic GTPase activity. They are involved in signal transduction and the regulation of a variety of cellular processes, including cell growth, transformation, differentiation and morphogenesis, nucleocytoplasmic transport, and apoptosis. Ras proteins promote cancer by disrupting the normal controls of cell proliferation and differentiation. All Ras subgroups (Ras, Rho, Rab, Ran, and ADP ribosylation factor) contain five highly conserved domains (G1-G5) and act as molecular switches by alternating between an active GTP-bound form and an inactive GDP-bound form. Rit2 (Ras-like protein in neurons) and Rit1 (Ras-like protein in tissues) share 50% homology to Ras. Both contain the five highly conserved domains (G1-G5), bind GTP in vitro, and are membrane-associated. However, both lack a CAAX box and their mechanism of membrane association is distinct from the typical Ras protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4697
Species: Hu
Applications: WB
NBP1-46159
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-75643
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-2385
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB59151
Species: Mu
Applications: WB
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
H00006014-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for Rit2 Antibody (H00006014-M01) (0)

There are no publications for Rit2 Antibody (H00006014-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rit2 Antibody (H00006014-M01) (0)

There are no reviews for Rit2 Antibody (H00006014-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rit2 Antibody (H00006014-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Rit2 Products

Bioinformatics Tool for Rit2 Antibody (H00006014-M01)

Discover related pathways, diseases and genes to Rit2 Antibody (H00006014-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rit2 Antibody (H00006014-M01)

Discover more about diseases related to Rit2 Antibody (H00006014-M01).
 

Pathways for Rit2 Antibody (H00006014-M01)

View related products by pathway.

Research Areas for Rit2 Antibody (H00006014-M01)

Find related products by research area.

Blogs on Rit2

There are no specific blogs for Rit2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rit2 Antibody (3F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol RIT2
Entrez
Uniprot