Rit2 Antibody (3F2) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
RIT2 (AAH18060, 1 a.a. ~ 217 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLKKKRENMT |
| Localization |
Plasma membrane |
| Specificity |
RIT2 - Ras-like without CAAX 2 |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
RIT2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Rit2 Antibody (3F2) - Azide and BSA Free
Background
The Ras super-family comprises a group of structurally related low molecular weight (20-30 kDa) proteins, which bind GTP or GDP and exhibit a low intrinsic GTPase activity. They are involved in signal transduction and the regulation of a variety of cellular processes, including cell growth, transformation, differentiation and morphogenesis, nucleocytoplasmic transport, and apoptosis. Ras proteins promote cancer by disrupting the normal controls of cell proliferation and differentiation. All Ras subgroups (Ras, Rho, Rab, Ran, and ADP ribosylation factor) contain five highly conserved domains (G1-G5) and act as molecular switches by alternating between an active GTP-bound form and an inactive GDP-bound form. Rit2 (Ras-like protein in neurons) and Rit1 (Ras-like protein in tissues) share 50% homology to Ras. Both contain the five highly conserved domains (G1-G5), bind GTP in vitro, and are membrane-associated. However, both lack a CAAX box and their mechanism of membrane association is distinct from the typical Ras protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Bv, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB, ELISA
Publications for Rit2 Antibody (H00006014-M01) (0)
There are no publications for Rit2 Antibody (H00006014-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Rit2 Antibody (H00006014-M01) (0)
There are no reviews for Rit2 Antibody (H00006014-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Rit2 Antibody (H00006014-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Rit2 Products
Research Areas for Rit2 Antibody (H00006014-M01)
Find related products by research area.
|
Blogs on Rit2