Recombinant Human Ring finger protein 138 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Ring finger protein 138 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 51-150 of Human Ring finger protein 138

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQENTS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RNF138
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ring finger protein 138 GST (N-Term) Protein

  • E3 ubiquitin-protein ligase RNF138
  • EC 6.3.2.-
  • hNARF
  • HSD-4
  • MGC8758
  • NARF
  • Nemo-like kinase-associated RING finger protein
  • ring finger protein 138NLK-associated RING finger protein
  • STRIN

Background

RNF138 - ring finger protein 138

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NB100-1218
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
MAB7665
Species: Hu
Applications: IHC, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-78703
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-54805
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
NBP1-31341
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, S-ELISA, WB
MEP00B
Species: Mu
Applications: ELISA
NB100-58824
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IP, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-32264
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB

Publications for Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01) (0)

There are no publications for Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01) (0)

There are no reviews for Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ring finger protein 138 Products

Bioinformatics Tool for Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01)

Discover related pathways, diseases and genes to Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01)

Discover more about diseases related to Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01).
 

Pathways for Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01)

View related products by pathway.

PTMs for Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01)

Learn more about PTMs related to Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01).
 

Research Areas for Ring finger protein 138 Partial Recombinant Protein (H00051444-Q01)

Find related products by research area.

Blogs on Ring finger protein 138

There are no specific blogs for Ring finger protein 138, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ring finger protein 138 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF138