RIC1 Antibody

Images

 
Immunohistochemistry-Paraffin: RIC1 Antibody [NBP2-49012] - KIAA1432 Antibody [NBP2-49012] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YCATLDGFAVVFNDGKVGFITPVSSRFTAEQLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYPD
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RIC1 Recombinant Protein Antigen (NBP2-49012PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIC1 Antibody

  • BA207C16.1
  • CIP150
  • Connexin 43-Interacting Protein 150 KDa
  • Connexin-43-Interacting Protein Of 150 KDa
  • Protein RIC1 Homolog
  • RAB6A GEF Complex Partner 1
  • RIC1 Homolog, RAB6A GEF Complex Partner 1
  • RIC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-49600
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF3994
Species: Hu
Applications: WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-74359
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
H00003429-A01
Species: Hu
Applications: ELISA, IHC, IHC-Fr, WB
3626-ML/CF
Species: Mu
Applications: BA
NBP1-93465
Species: Hu
Applications: IHC, IHC-P
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-13970
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-94538
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB7557
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RIC1 Antibody (NBP2-49012) (0)

There are no publications for RIC1 Antibody (NBP2-49012).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIC1 Antibody (NBP2-49012) (0)

There are no reviews for RIC1 Antibody (NBP2-49012). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RIC1 Antibody (NBP2-49012) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIC1 Products

Array NBP2-49012

Bioinformatics Tool for RIC1 Antibody (NBP2-49012)

Discover related pathways, diseases and genes to RIC1 Antibody (NBP2-49012). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIC1 Antibody (NBP2-49012)

Discover more about diseases related to RIC1 Antibody (NBP2-49012).
 

Pathways for RIC1 Antibody (NBP2-49012)

View related products by pathway.

PTMs for RIC1 Antibody (NBP2-49012)

Learn more about PTMs related to RIC1 Antibody (NBP2-49012).

Blogs on RIC1

There are no specific blogs for RIC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIC1