Rho GTPase activating protein 39 Antibody

Images

 

Order Details


    • Catalog Number
      NBP1-90619
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Rho GTPase activating protein 39 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEPDTEKAQELPARAGRPAAFGTVKEDSGSSSPPGVFLEKDYEIYRDYSADGQLLHYRTSSLRWNSGAKERMLIKVADRE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP39
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rho GTPase activating protein 39 Antibody

  • KIAA1688
  • Rho GTPase activating protein 39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
5444-SL
Species: Mu
Applications: BA
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP2-00810
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
MAB3629
Species: Mu
Applications: IHC
NBP1-87076
Species: Hu
Applications: IHC, IHC-P, WB
AF1749
Species: Rt
Applications: IHC, WB
NBP1-87914
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-58780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90619
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Rho GTPase activating protein 39 Antibody (NBP1-90619) (0)

There are no publications for Rho GTPase activating protein 39 Antibody (NBP1-90619).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rho GTPase activating protein 39 Antibody (NBP1-90619) (0)

There are no reviews for Rho GTPase activating protein 39 Antibody (NBP1-90619). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Rho GTPase activating protein 39 Antibody (NBP1-90619) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Bioinformatics Tool for Rho GTPase activating protein 39 Antibody (NBP1-90619)

Discover related pathways, diseases and genes to Rho GTPase activating protein 39 Antibody (NBP1-90619). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Rho GTPase activating protein 39

There are no specific blogs for Rho GTPase activating protein 39, but you can read our latest blog posts.
Omicron Variant Antibodies

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rho GTPase activating protein 39 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP39