Recombinant Human RHCG GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RHCG GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 418-479 of Human RHCG

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RHCG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
32.56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RHCG GST (N-Term) Protein

  • ammonium transporter Rh type C
  • CDRC2
  • chromosome 15 open reading frame 6
  • PDRC2C15orf6
  • Rh family type C glycoprotein
  • Rh family, C glycoprotein
  • Rh glycoprotein kidney
  • Rh type C glycoprotein
  • Rhesus blood group family type C glycoprotein
  • Rhesus blood group, C glycoprotein
  • RHGKTumor-related protein DRC2
  • SLC42A3

Background

RHCG - Rhesus blood group, C glycoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-17923
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-84247
Species: Hu
Applications: WB
NBP2-33527
Species: Hu, Mu
Applications: IHC, IHC-P
H00006005-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-46516
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-72961
Species: Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
MAB1936
Species: Hu
Applications: IP, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NB110-81529
Species: Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IP, KD, KO, Simple Western, WB
NBP1-85064
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB4218
Species: Hu
Applications: IHC, WB
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
H00051458-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for RHCG Partial Recombinant Protein (H00051458-Q01) (0)

There are no publications for RHCG Partial Recombinant Protein (H00051458-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHCG Partial Recombinant Protein (H00051458-Q01) (0)

There are no reviews for RHCG Partial Recombinant Protein (H00051458-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHCG Partial Recombinant Protein (H00051458-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RHCG Products

Bioinformatics Tool for RHCG Partial Recombinant Protein (H00051458-Q01)

Discover related pathways, diseases and genes to RHCG Partial Recombinant Protein (H00051458-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHCG Partial Recombinant Protein (H00051458-Q01)

Discover more about diseases related to RHCG Partial Recombinant Protein (H00051458-Q01).
 

Pathways for RHCG Partial Recombinant Protein (H00051458-Q01)

View related products by pathway.

PTMs for RHCG Partial Recombinant Protein (H00051458-Q01)

Learn more about PTMs related to RHCG Partial Recombinant Protein (H00051458-Q01).
 

Research Areas for RHCG Partial Recombinant Protein (H00051458-Q01)

Find related products by research area.

Blogs on RHCG

There are no specific blogs for RHCG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RHCG GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RHCG