RHBDD1 Antibody

Immunocytochemistry/Immunofluorescence: RHBDD1 Antibody [NBP2-55395] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.

Product Discontinued

RHBDD1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLNPQKPLYSSCLSVEKCYQQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHBDD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RHBDD1 Recombinant Protein Antigen (NBP2-55395PEP)

Reactivity Notes

Mouse 88%, Rat 83%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RHBDD1 Antibody

• DKFZp547E052
• EC 3.4.21
• EC 3.4.21.-
• MGC117258
• rhomboid domain containing 1
• rhomboid domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHBDD1