RGS20 Antibody

Images

 
Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667] - Analysis in human cerebral cortex and pancreas tissues using Anti-RGS20 antibody. Corresponding RGS20 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RGS20 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGS20
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RGS20 Recombinant Protein Antigen (NBP2-62667PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for RGS20 Antibody

  • G(z)GAP
  • Gz-GAP
  • Gz-selective GTPase-activating protein
  • regulator of G-protein signaling 20
  • Regulator of G-protein signaling Z1
  • regulator of G-protein signalling 20
  • Regulator of Gz-selective protein signaling 1
  • RGSZ1g(z)GAP
  • ZGAP1gz-GAP

Background

Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi (see GNAI1; MIM 139310) and Gq (see GNAQ; MIM 600998) class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24516
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-33694
Species: Hu
Applications: ICC/IF, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-88111
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-49461
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, In vitro, In vivo, KD, WB
NB100-1353
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-83257
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86020
Species: Hu
Applications: IHC, IHC-P, WB
H00005997-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
NBP2-94071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006000-B01P
Species: Hu, Rt
Applications: Flow, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NB100-1029
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB

Publications for RGS20 Antibody (NBP2-62667) (0)

There are no publications for RGS20 Antibody (NBP2-62667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS20 Antibody (NBP2-62667) (0)

There are no reviews for RGS20 Antibody (NBP2-62667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RGS20 Antibody (NBP2-62667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS20 Products

Bioinformatics Tool for RGS20 Antibody (NBP2-62667)

Discover related pathways, diseases and genes to RGS20 Antibody (NBP2-62667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS20 Antibody (NBP2-62667)

Discover more about diseases related to RGS20 Antibody (NBP2-62667).
 

Pathways for RGS20 Antibody (NBP2-62667)

View related products by pathway.

PTMs for RGS20 Antibody (NBP2-62667)

Learn more about PTMs related to RGS20 Antibody (NBP2-62667).
 

Research Areas for RGS20 Antibody (NBP2-62667)

Find related products by research area.

Blogs on RGS20

There are no specific blogs for RGS20, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS20