Home » RGS20 » RGS20 Antibodies » RGS20 Antibody

RGS20 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667] - Analysis in human cerebral cortex and pancreas tissues using Anti-RGS20 antibody. Corresponding RGS20 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: RGS20 Antibody [NBP2-62667] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

RGS20 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGS20
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RGS20 Recombinant Protein Antigen (NBP2-62667PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for RGS20 Antibody

  • G(z)GAP
  • Gz-GAP
  • Gz-selective GTPase-activating protein
  • regulator of G-protein signaling 20
  • Regulator of G-protein signaling Z1
  • regulator of G-protein signalling 20
  • Regulator of Gz-selective protein signaling 1
  • RGSZ1g(z)GAP
  • ZGAP1gz-GAP

Background

Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi (see GNAI1; MIM 139310) and Gq (see GNAQ; MIM 600998) class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RGS19 Antibody
NBP2-24516
Immunohistochemistry-Paraffin: RGS19 Antibody [NBP2-24516] - analysis of RGS19 in paraffin-embedded formalin-fixed human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
Western Blot: RGS19 Antibody [NBP2-24516] - Analysis of RGS19 in mouse placenta lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24516 at 1.0 ug/ml.
Species: Hu, Mu
Applications: IHC, IHC-P, WB
RGS17 Antibody
NBP1-33694
Immunocytochemistry/Immunofluorescence: RGS17 Antibody [NBP1-33694] - Paraformaldehyde-fixed A431, using antibody at 1:200 dilution.
Western Blot: RGS17 Antibody [NBP1-33694] - Hep G2 lysates using NBP1-33694 at a dilution of 1:1000. 30ug whole cell lysate loaded on 12% SDS PAGE gel.
Western Blot: RGS17 Antibody [NBP1-33694] - Sample (30 ug of whole cell lysate) A: Non-transfected 293T lysates B: RGS17 transfected 293T lysates 12% SDS PAGE; antibody diluted at 1:5000.
Species: Hu
Applications: ICC/IF, WB
SUCLG1 Antibody
NBP1-32728
Immunocytochemistry/Immunofluorescence: SUCLG1 Antibody [NBP1-32728] - Sample: HeLa cells were fixed in 2% paraformaldehyde/culture medium at 37C for 30 min. Green: SUCLG1 protein stained by SUCLG1 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-32728] - N87 xenograft, using SUCLG1antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: SUCLG1 Antibody [NBP1-32728] - Sample (20 ug of whole cell lysate) A: mouse brain 10% SDS PAGE; antibody diluted at 1:10000.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
G Protein alpha z
Antibody
NBP1-88111
Immunocytochemistry/Immunofluorescence: G Protein alpha z Antibody [NBP1-88111] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Western Blot: G Protein alpha z Antibody [NBP1-88111] - Analysis in control (vector only transfected HEK293T lysate) and GNAZ over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: G Protein alpha z Antibody [NBP1-88111] - Analysis in human cerebral cortex and liver tissues. Corresponding G Protein alpha z RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Stathmin-2/STMN2
Antibody
NBP1-49461
Immunohistochemistry-Frozen: Stathmin-2/STMN2 Antibody [NBP1-49461] - Stathmin-2/STMN2 immunoreactivity at the trigeminal root entry zone (antibody diluted 1:1000, tissue taken from a mouse with experimental autoimmune encephalomyelitis). Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Stathmin-2/STMN2 Antibody [NBP1-49461] - Staining of STMN2 in HEK293T cells transfected with GFP or a GFP-STMN2 fusion. NBP1-49461 was used at a dilution of 1:1000 (A, B) and 1:3000 (C). Image courtesy of Dr. Jung Eun Shin.
Immunocytochemistry/Immunofluorescence: Stathmin-2/STMN2 Antibody [NBP1-49461] - Staining of STMN2 in primary mouse dorsal root ganglia (DRG) neurons Image shows the expected staining of endogenous STMN2 in axons and growth cones. Tubulin is a marker of axons. NBP1-49461 was used at a dilution of 1:4000. Image courtesy of Dr. Jung Eun Shin.
(2 Reviews)
(52 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, In vitro, In vivo, KD, WB
GIPC1 Antibody
NB100-1353
Western Blot: GIPC1 Antibody [NB100-1353] - Staining (1ug/ml) of Hela lysate (RIPA buffer, 30ug total protein per lane). Primary incubated for 1 hour. Detected by western blot using chemiluminescence.
Immunohistochemistry: GIPC1 Antibody [NB100-1353] - Staining of paraffin embedded Human Kidney. Microwaved antigen retrieval with Tris/EDTA buffer pH9, HRP-staining.
Western Blot: GIPC1 Antibody [NB100-1353] - HEK293 overexpressing GIPC1 isoform 1 (RC216466) and probed with NB100-1353 (mock transfection in first lane).
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
HINT1 Antibody
NBP1-83257
Immunocytochemistry/Immunofluorescence: HINT1 Antibody [NBP1-83257] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RGS10 Antibody
NBP1-86020
Immunohistochemistry-Paraffin: RGS10 Antibody [NBP1-86020] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: RGS10 Antibody [NBP1-86020] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: RGS10 Antibody [NBP1-86020] - Staining in human lymph node and pancreas tissues using anti-RGS10 antibody. Corresponding RGS10 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
RGS2 Antibody (4C4)
H00005997-M01
Western Blot: RGS2 Antibody (4C4) [H00005997-M01] - RGS2 monoclonal antibody (M01), clone 4C4 Analysis of RGS2 expression in MCF-7.
Knockdown Validated: RGS2 Antibody (4C4) [H00005997-M01] - Knockdown efficiencies of target proteins in HEK293 cells measured by Reverse Phase Protein Array (RPPA) and Western blotting (WB). Level of expression by WB and RPPA of targeted proteins in HEK293 cells transfected with siRNA targeting proteins of interest or non-silencing siRNA control (siCTR). Specific bands for WB and spots corresponding to the dilution of the dynamic range in RPPA are presented. Image collected and cropped by CiteAb from the following publication (http://rbej.biomedcentral.com/articles/10.1186/1477-7827-11-100) licensed under a CC-BY licence.
Western Blot: RGS2 Antibody (4C4) [H00005997-M01] - Specificity of antibodies. HEK293 cells lysates were analysed by Western blotting to test the specificity of antibodies. Image collected and cropped by CiteAb from the following publication (http://rbej.biomedcentral.com/articles/10.1186/1477-7827-11-100) licensed under a CC-BY licence.
(6 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
RGS4 Antibody
NBP2-94071
Immunocytochemistry/Immunofluorescence: RGS4 Antibody [NBP2-94071] - Analysis of L929 cells using RGS4 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: RGS4 Antibody [NBP2-94071] - Analysis of U-2 OS cells using RGS4 at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: RGS4 Antibody [NBP2-94071] - Analysis of extracts of various cell lines, using RGS4 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 1s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RGS7 Antibody
H00006000-B01P
Flow Cytometry: RGS7 Antibody [H00006000-B01P] - Analysis of negative control 293 cells (Black) and RGS7 expressing 293 cells (Green) using RGS7 purified mouse polyclonal antibody.
Western Blot: RGS7 Antibody [H00006000-B01P] - Analysis of RGS7 expression in transfected 293T cell line by RGS7 polyclonal antibody. Lane 1: RGS7 transfected lysate(53.57 KDa). Lane 2: Non-transfected lysate.
Western Blot: RGS7 Antibody [H00006000-B01P] - Analysis of RGS7 expression in rat brain.
Species: Hu, Rt
Applications: Flow, WB
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western lane view shows lysates of Raji human Burkitt's lymphoma cell line and Daudi human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for PAG1 at approximately 76 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human PAG1 Monoclonal Antibody (Catalog # MAB5285). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line and Raji human Burkitt's lymphoma cell line. PVDF Membrane was probed with 1 µg/mL of Human PAG1 Polyclonal Antibody (Catalog # MAB5285) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for PAG1 at approximately 70-85 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: Simple Western, WB
RGS1 Antibody
NB100-1029
Western Blot: RGS1 Antibody [NB100-1029] - (1ug/ml) of HepG2 lysate (RIPA buffer, 30ug total protein per lane). Primary incubated for 1 hour. Detected by western blot using chemiluminescence.
Immunohistochemistry-Paraffin: RGS1 Antibody [NB100-1029] - staining of paraffin embedded Human Small Intestine. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: RGS1 Antibody [NB100-1029] - staining of paraffin embedded Human Thymus. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Peroxiredoxin 1
Antibody
NBP1-82558
Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DIO2 Antibody
NBP1-00178
Flow Cytometry: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed MCF7 cells (blue line), permeabilized with 0.5%Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody
Immunocytochemistry/Immunofluorescence: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton.Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).
Immunohistochemistry-Frozen: DIO2 Antibody [NBP1-00178] - IHC analysis of DIO2 in cryo-sectioned Mouse Hippocampus using NBP1-00178 at 2ug/ml. Microwaved antigen retrieval with citrate buffer pH 4.5, HRP-staining.
(7 Publications)
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB

Publications for RGS20 Antibody (NBP2-62667) (0)

There are no publications for RGS20 Antibody (NBP2-62667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS20 Antibody (NBP2-62667) (0)

There are no reviews for RGS20 Antibody (NBP2-62667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RGS20 Antibody (NBP2-62667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS20 Products

Bioinformatics Tool for RGS20 Antibody (NBP2-62667)

Discover related pathways, diseases and genes to RGS20 Antibody (NBP2-62667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS20 Antibody (NBP2-62667)

Discover more about diseases related to RGS20 Antibody (NBP2-62667).
 

Pathways for RGS20 Antibody (NBP2-62667)

View related products by pathway.

PTMs for RGS20 Antibody (NBP2-62667)

Learn more about PTMs related to RGS20 Antibody (NBP2-62667).
 

Research Areas for RGS20 Antibody (NBP2-62667)

Find related products by research area.

Blogs on RGS20

There are no specific blogs for RGS20, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS20 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RGS20