RGS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RGS2 Antibody [NBP2-55551] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDL
Specificity
Specificity of human RGS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGS2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RGS2 Recombinant Protein Antigen (NBP2-55551PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RGS2 Antibody

  • Cell growth-inhibiting gene 31 protein
  • G0 to G1 switch regulatory 8, 24kD
  • G0/G1 switch regulatory protein 8
  • G0S8cell growth-inhibiting protein 31
  • regulator of G-protein signaling 2
  • regulator of G-protein signaling 2, 24kDa
  • regulator of G-protein signalling 2, 24kD
  • regulator of G-protein signalling 2, 24kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-32728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-00880
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00005998-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-84903
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NLS2576
Species: Hu, Rt, Pm
Applications: IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
NLS2272
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NLS2756
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for RGS2 Antibody (NBP2-55551) (0)

There are no publications for RGS2 Antibody (NBP2-55551).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS2 Antibody (NBP2-55551) (0)

There are no reviews for RGS2 Antibody (NBP2-55551). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RGS2 Antibody (NBP2-55551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RGS2 Products

Bioinformatics Tool for RGS2 Antibody (NBP2-55551)

Discover related pathways, diseases and genes to RGS2 Antibody (NBP2-55551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS2 Antibody (NBP2-55551)

Discover more about diseases related to RGS2 Antibody (NBP2-55551).
 

Pathways for RGS2 Antibody (NBP2-55551)

View related products by pathway.

PTMs for RGS2 Antibody (NBP2-55551)

Learn more about PTMs related to RGS2 Antibody (NBP2-55551).
 

Research Areas for RGS2 Antibody (NBP2-55551)

Find related products by research area.

Blogs on RGS2

There are no specific blogs for RGS2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS2