RGP1 Antibody

Images

 
Western Blot: RGP1 Antibody [NBP2-88149] - Host: Rabbit. Target Name: RGP1. Sample Type: HepG2 Whole cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGP1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human RGP1. Peptide sequence: RVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RGP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RGP1 Antibody

  • retrograde Golgi transport protein RGP1 homolog
  • RGP1 retrograde golgi transport homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24664
Species: Hu, Mu, Rt
Applications: Flow, WB
NBP2-15085
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1049
Species: Hu
Applications: IHC, WB
NBP1-90857
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
NBP2-33414
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00006293-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-12461
Species: Hu, Rt
Applications: ELISA, IP, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RGP1 Antibody (NBP2-88149) (0)

There are no publications for RGP1 Antibody (NBP2-88149).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGP1 Antibody (NBP2-88149) (0)

There are no reviews for RGP1 Antibody (NBP2-88149). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGP1 Antibody (NBP2-88149) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGP1 Products

Bioinformatics Tool for RGP1 Antibody (NBP2-88149)

Discover related pathways, diseases and genes to RGP1 Antibody (NBP2-88149). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGP1 Antibody (NBP2-88149)

Discover more about diseases related to RGP1 Antibody (NBP2-88149).
 

Pathways for RGP1 Antibody (NBP2-88149)

View related products by pathway.

PTMs for RGP1 Antibody (NBP2-88149)

Learn more about PTMs related to RGP1 Antibody (NBP2-88149).

Blogs on RGP1

There are no specific blogs for RGP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGP1