RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free

Immunohistochemistry-Paraffin: RGM-C/Hemojuvelin Antibody (1C12) [H00148738-M01] - Analysis of monoclonal antibody to HFE2 on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.

Sandwich ELISA: RGM-C/Hemojuvelin Antibody (1C12) [H00148738-M01] - Detection limit for recombinant GST tagged HFE2 is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1C12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free Summary

• Immunogen: HFE2 (NP_973733, 93 a.a. ~ 173 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPS
• Specificity: HFE2 - hemochromatosis type 2 (juvenile) (1C12)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HJV
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RGM-C/Hemojuvelin Antibody (1C12) - Azide and BSA Free

• DL-M
• haemojuvelin
• hemochromatosis type 2 (juvenile)
• Hemojuvelin
• HFE2
• HFE2AMGC23953
• HJV
• HJVHemochromatosis type 2 protein
• JH
• repulsive guidance molecule c
• RGMC
• RGM-C
• RGMCRGM domain family member C

Background

The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RGM-C/Hemojuvelin Antibody (H00148738-M01)(1)

Publication using H00148738-M01

• Young G, Tang S, Wu V et al. The functional role of hemojuvelin in acute ischemic stroke. J Cereb Blood Flow Metab. 2019-07-15 [PMID: 31307288]

Bioinformatics

• Gene Symbol: HJV
• Entrez:
  • 148738(Human)
• Uniprot:
  • NP_973733(Human)