RFX4 Antibody

Images

 
Western Blot: RFX4 Antibody [NBP2-88144] - WB Suggested Anti-RFX4 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:1562500. Positive Control: 293T cell lysate

Product Details

Summary
Reactivity Hu, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RFX4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RFX4. Peptide sequence: NVDLNSITKQTLYTMEDSRDEHRKLITQLYQEFDHLLEEQSPIESYIEWL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Equine (93%), Canine (93%), Rabbit (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
RFX4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for RFX4 Antibody

  • NYD-SP10
  • Regulatory factor X 4
  • regulatory factor X, 4 (influences HLA class II expression)
  • regulatory factor X4
  • Testis development protein NYD-SP10
  • transcription factor NYD-sp10
  • transcription factor RFX4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52654
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-195
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-13224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4736
Species: Hu
Applications: WB
NBP1-86301
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-58997
Species: Hu
Applications: WB, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NB600-600
Species: Hu, Mu, Ca
Applications: WB, ChIP, ELISA, Flow, IB, IHC, IHC-P, Flow-IC, KD
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-68766
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-85666
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92895
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-88144
Species: Hu, Ca, Eq, Rb
Applications: WB

Publications for RFX4 Antibody (NBP2-88144) (0)

There are no publications for RFX4 Antibody (NBP2-88144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFX4 Antibody (NBP2-88144) (0)

There are no reviews for RFX4 Antibody (NBP2-88144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFX4 Antibody (NBP2-88144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RFX4 Products

Bioinformatics Tool for RFX4 Antibody (NBP2-88144)

Discover related pathways, diseases and genes to RFX4 Antibody (NBP2-88144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFX4 Antibody (NBP2-88144)

Discover more about diseases related to RFX4 Antibody (NBP2-88144).
 

Pathways for RFX4 Antibody (NBP2-88144)

View related products by pathway.

PTMs for RFX4 Antibody (NBP2-88144)

Learn more about PTMs related to RFX4 Antibody (NBP2-88144).

Blogs on RFX4

There are no specific blogs for RFX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFX4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFX4