REV1 Antibody

Images

 
Western Blot: REV1 Antibody [NBP2-13219] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: REV1 Antibody [NBP2-13219] - Staining of human kidney shows cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

REV1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TNLNPSTCPSRPSVQSSHFPSGSYSVRDVFQVQKAKKSTEEEHKEVFRAA VDLEISSASRTCTFLPPFPAHLPTSPDTNKAESSGKWNGLHTPVSVQSRL NLSIEVPSPSQLDQSVLEALPPDLREQVEQVCAVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
REV1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
REV1 Protein (NBP2-13219PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-13219 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for REV1 Antibody

  • AIBP80
  • Alpha integrin-binding protein 80
  • DNA repair protein REV1
  • EC 2.7.7.-
  • FLJ21523
  • MGC163283
  • MGC26225
  • REV1 (yeast homolog)- like
  • REV1 homolog (S. cerevisiae)
  • REV1- like
  • REV1L
  • REV1-like (yeast)
  • Rev1-like terminal deoxycytidyl transferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39036
Species: Hu
Applications: IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00010459-D01P
Species: Hu
Applications: WB, ELISA
AF3417
Species: Hu
Applications: WB
NBP2-13729
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00051426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00010721-M09
Species: Hu
Applications: WB, ELISA
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-57664
Species: Hu
Applications: WB, ICC/IF
NB100-175
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for REV1 Antibody (NBP2-13219) (0)

There are no publications for REV1 Antibody (NBP2-13219).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for REV1 Antibody (NBP2-13219) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP2-13219:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot REV1 NBP2-13219
Enlarge
reviewed by:
Anonymous
WB Human 09/03/2014
View

Summary

ApplicationWestern Blot
Sample TestedLysate from U2OS cells
SpeciesHuman

Blocking

Blocking Details5% NFDM in PBS+0.1% Triton

Primary Anitbody

Dilution Ratio700 times diluted in PBS, incubated for 2 hours at room temperature

Secondary Antibody

Secondary DescriptionAnti-rabbit IgG, HRP-linked Antibody (Cell Signaling)
Secondary Manufacturer Cat##7074
Secondary Concentration20:000

Details

Detection NotesCaptured using X-rays (5 sec exposure) with Phototope-HRP Western Blot Detection System

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REV1 Antibody (NBP2-13219) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional REV1 Products

Bioinformatics Tool for REV1 Antibody (NBP2-13219)

Discover related pathways, diseases and genes to REV1 Antibody (NBP2-13219). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REV1 Antibody (NBP2-13219)

Discover more about diseases related to REV1 Antibody (NBP2-13219).
 

Pathways for REV1 Antibody (NBP2-13219)

View related products by pathway.

PTMs for REV1 Antibody (NBP2-13219)

Learn more about PTMs related to REV1 Antibody (NBP2-13219).

Blogs on REV1

There are no specific blogs for REV1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
09/03/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol REV1