REPS2 Antibody - BSA Free

Western Blot: REPS2 Antibody [NBP2-85623] - Host: Rabbit. Target Name: REPS2. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/mlREPS2 is supported by BioGPS gene expression data to be expressed in 721_B

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

REPS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit REPS2 Antibody - BSA Free (NBP2-85623) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human REPS2. Peptide sequence: KDVLYSQPPSKPIRRKFRPENQATENQEPSTAASGPASAATMKPHPTVQK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: REPS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for REPS2 Antibody - BSA Free

• partner of Ral-binding protein 1
• POB1Partner of RalBP1
• RALBP1 associated Eps domain containing 2
• ralBP1-associated Eps domain-containing protein 2
• RalBP1-interacting protein 2

Background

The product of this gene is part of a protein complex that regulates the endocytosis of growth factor receptors. The encoded protein directly interacts with a GTPase activating protein that functions downstream of the small G protein Ral. Its expression can negatively affect receptor internalization and inhibit growth factor signaling. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: REPS2