RELT/TNFRSF19L Antibody (3F8)

Images

 
Western Blot: RELT/TNFRSF19L Antibody (3F8) [H00084957-M01] - Analysis of TNFRSF19L expression in transfected 293T cell line by TNFRSF19L monoclonal antibody (M01), clone 3F8.Lane 1: TNFRSF19L transfected lysate(46.1 ...read more
Western Blot: RELT/TNFRSF19L Antibody (3F8) [H00084957-M01] - Analysis of TNFRSF19L over-expressed 293 cell line, cotransfected with TNFRSF19L Validated Chimera RNAi ( Cat # H00084957-R01V ) (Lane 2) or non-transfected ...read more
Sandwich ELISA: RELT/TNFRSF19L Antibody (3F8) [H00084957-M01] - Detection limit for recombinant GST tagged RELT is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA, KD
Clone
3F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RELT/TNFRSF19L Antibody (3F8) Summary

Immunogen
TNFRSF19L (NP_116260, 26 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEW
Specificity
TNFRSF19L - tumor necrosis factor receptor superfamily, member 19-like
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RELT
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Has also been used for RNAi validation.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RELT/TNFRSF19L Antibody (3F8)

  • Receptor expressed in lymphoid tissues
  • RELT tumor necrosis factor receptor
  • RELT
  • TNFRSF19L
  • TNFRSF19LFLJ14993
  • tumor necrosis factor receptor superfamily member 19L
  • tumor necrosis factor receptor superfamily, member 19-like

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). This receptor is capable of stimulating T-cell proliferation in the presence of CD3 signaling, which suggests its regulatory role in immune response. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

210-TA
Species: Hu
Applications: BA
NBP1-48021
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00009943-M16
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP3-16183
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90886
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3388
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
375-TL
Species: Hu
Applications: BA
NBP1-91725
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF723
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
H00130497-M10
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB
NBP1-85081
Species: Hu
Applications: IHC, IHC-P, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
H00084957-M01
Species: Hu
Applications: WB, ELISA, S-ELISA, KD

Publications for RELT/TNFRSF19L Antibody (H00084957-M01) (0)

There are no publications for RELT/TNFRSF19L Antibody (H00084957-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RELT/TNFRSF19L Antibody (H00084957-M01) (0)

There are no reviews for RELT/TNFRSF19L Antibody (H00084957-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RELT/TNFRSF19L Antibody (H00084957-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RELT/TNFRSF19L Products

Bioinformatics Tool for RELT/TNFRSF19L Antibody (H00084957-M01)

Discover related pathways, diseases and genes to RELT/TNFRSF19L Antibody (H00084957-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RELT/TNFRSF19L Antibody (H00084957-M01)

Discover more about diseases related to RELT/TNFRSF19L Antibody (H00084957-M01).
 

Pathways for RELT/TNFRSF19L Antibody (H00084957-M01)

View related products by pathway.

PTMs for RELT/TNFRSF19L Antibody (H00084957-M01)

Learn more about PTMs related to RELT/TNFRSF19L Antibody (H00084957-M01).
 

Research Areas for RELT/TNFRSF19L Antibody (H00084957-M01)

Find related products by research area.

Blogs on RELT/TNFRSF19L

There are no specific blogs for RELT/TNFRSF19L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RELT/TNFRSF19L Antibody (3F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol RELT
Entrez
Uniprot