Recombinant Human RELM beta Protein Summary
| Description |
Recombinant protein corresponding to the amino acids 1-89 of Human RETNLB partial Source: Escherichia coli Amino Acid Sequence:MQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
RETNLB |
| Purity |
>90% SDS-PAGE |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
Lyophilized from 0.1% TFA |
| Preservative |
No Preservative |
| Concentration |
LYOPH |
| Purity |
>90% SDS-PAGE |
| Reconstitution Instructions |
Reconstitute with distilled water. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human RELM beta Protein
Background
RELM beta is a family of resistin-like molecules (RELMs) has been identified in rodents and humans. Resistin is a hormone produced by fat cells. RELMalpha is a secreted protein that has a restricted tissue distribution with highest levels in adipose tissue. Another family member, RELMbeta, is a secreted protein expressed only in the gastrointestinal tract, particularly the colon, in both mouse and human. RELMbeta gene expression is highest in proliferative epithelial cells and is markedly increased in tumors, suggesting a role in intestinal proliferation. Resistin and the RELMs share a cysteine composition and other signature features. Thus, the RELMs together with resistin comprise a class of tissue-specific signaling molecules. mRELM-alpha should migrate as a monomer under complete reducing conditions. However, it migrates as dimers, trimers, and even higher order multimers under non-reducing conditions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Mu
Applications: BA
Species: Hu
Applications: Simple Western, WB
Publications for RELM beta Recombinant Protein (P4436) (0)
There are no publications for RELM beta Recombinant Protein (P4436).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RELM beta Recombinant Protein (P4436) (0)
There are no reviews for RELM beta Recombinant Protein (P4436).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for RELM beta Recombinant Protein (P4436) (0)
Additional RELM beta Products
Research Areas for RELM beta Recombinant Protein (P4436)
Find related products by research area.
|
Blogs on RELM beta