RELM beta Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

RELM beta Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RETNLB.
  
  

  Source: E. coli

  Amino Acid Sequence: LDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: RETNLB
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13218.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RELM beta Recombinant Protein Antigen

• C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich proteinprecursor 2
• CCRG
• Colon and small intestine-specific cysteine-rich protein
• Colon carcinoma-related gene protein
• cysteine-rich secreted A12-alpha-like protein 1
• Cysteine-rich secreted protein A12-alpha-like 1
• Cysteine-rich secreted protein FIZZ2
• FIZZ1
• FIZZ2RELM-beta
• found in inflammatory zone 1
• HXCP2XCP2
• RELM beta
• RELMb
• RELMbeta
• resistin like beta
• resistin-like beta
• RETNL2

Background

RELM beta is a family of resistin-like molecules (RELMs) has been identified in rodents and humans. Resistin is a hormone produced by fat cells. RELMalpha is a secreted protein that has a restricted tissue distribution with highest levels in adipose tissue. Another family member, RELMbeta, is a secreted protein expressed only in the gastrointestinal tract, particularly the colon, in both mouse and human. RELMbeta gene expression is highest in proliferative epithelial cells and is markedly increased in tumors, suggesting a role in intestinal proliferation. Resistin and the RELMs share a cysteine composition and other signature features. Thus, the RELMs together with resistin comprise a class of tissue-specific signaling molecules. mRELM-alpha should migrate as a monomer under complete reducing conditions. However, it migrates as dimers, trimers, and even higher order multimers under non-reducing conditions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: RETNLB